Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06396.1.g00040.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 310aa    MW: 34155.1 Da    PI: 5.2567
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+WT+eEd llv++v+++G g+W++ ar  g++Rt+k+c++rw++yl 24 RGPWTAEEDVLLVNYVAKHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 71
                                  89********************************************97 PP

               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rg  T+ E++l++++++++G++ W+ Iar++  gRt++++k++w++  77 RGDITPAEQLLILELHARWGNR-WSEIARRLLPGRTDNEVKNYWRT 121
                                   6778******************.*******999***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.11975IPR017930Myb domain
SMARTSM007171.5E-162373IPR001005SANT/Myb domain
PfamPF002493.1E-182471IPR001005SANT/Myb domain
CDDcd001671.12E-132671No hitNo description
SMARTSM007172.2E-1276125IPR001005SANT/Myb domain
PROSITE profilePS5129414.99376127IPR017930Myb domain
PfamPF002495.4E-1277121IPR001005SANT/Myb domain
CDDcd001679.98E-1081121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700181.11e-107PREDICTED: transcriptional activator Myb
TrEMBLK3Z7F41e-107K3Z7F4_SETIT; Uncharacterized protein
STRINGSi022474m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number